PDB entry 1emi

View 1emi on RCSB PDB site
Description: structure of 16s rRNA in the region around ribosomal protein s8.
Class: ribosome
Keywords: RNA, rRNA, ribosome, ribosomal protein, 16S rRNA, S8
Deposited on 2000-03-16, released 2000-06-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 7.5 Å
R-factor: N/A
AEROSPACI score: -0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal protein s8
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SHQ2 (0-135)
      • conflict (22)
      • conflict (34)
      • conflict (49)
      • conflict (58-59)
      • conflict (78)
      • conflict (85)
      • conflict (112)
    Domains in SCOPe 2.04: d1emia_
  • Chain 'B':
    Compound: 16S ribosomal RNA
    Species: Thermus thermophilus [TaxId:274]

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1emiA (A:)
tdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylrvy
lkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvltdr
earklgvggelicevw

  • Chain 'B':
    No sequence available.