PDB entry 1emh

View 1emh on RCSB PDB site
Description: crystal structure of human uracil-DNA glycosylase bound to uncleaved substrate-containing DNA
Class: hydrolase/DNA
Keywords: alpha/beta fold, Uracil-DNA Glycosylase, protein/DNA, hydrolase-DNA COMPLEX
Deposited on 2000-03-16, released 2000-05-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil-DNA glycosylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13051 (0-222)
      • conflict (0-2)
    Domains in SCOPe 2.08: d1emha_
  • Chain 'B':
    Compound: DNA (5'-d(*tp*gp*tp*(p2u)p*ap*tp*cp*tp*t)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*ap*ap*ap*gp*ap*tp*ap*ap*cp*a)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1emhA (A:)
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.