PDB entry 1emf

View 1emf on RCSB PDB site
Description: green fluorescent protein from aequorea victoria, mutant
Class: luminescence
Keywords: fluorescent protein, beta-barrel, bioluminescence, luminescence
Deposited on 1997-03-31, released 1997-08-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-12, with a file datestamp of 2009-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.19
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212
      • engineered (64)
      • chromophore (65)
      • conflict (78)
      • engineered (161)
    Domains in SCOPe 2.07: d1emfa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1emfA (A:)
    maskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwpt
    lvttlxvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvn
    rielkgidfkedgnilghkleynynshnvyimadkqkngikanfkirhniedgsvqladh
    yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1emfA (A:)
    elftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvttlx
    vqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnrielkg
    idfkedgnilghkleynynshnvyimadkqkngikanfkirhniedgsvqladhyqqntp
    igdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit