PDB entry 1emc

View 1emc on RCSB PDB site
Description: green fluorescent protein from aequorea victoria, mutant
Class: luminescence
Keywords: fluorescent protein, beta-barrel, bioluminescence, luminescence
Deposited on 1997-03-31, released 1997-08-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-21, with a file datestamp of 2015-01-16.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.205
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212
      • engineered (64)
      • chromophore (66)
      • conflict (80)
      • engineered (167)
    Domains in SCOPe 2.07: d1emca_
  • Chain 'B':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212
      • engineered (64)
      • chromophore (66)
      • conflict (80)
      • engineered (167)
    Domains in SCOPe 2.07: d1emcb_
  • Chain 'C':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212
      • engineered (64)
      • chromophore (66)
      • conflict (80)
      • engineered (167)
    Domains in SCOPe 2.07: d1emcc_
  • Chain 'D':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Gene: GFP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212
      • engineered (64)
      • chromophore (66)
      • conflict (80)
      • engineered (167)
    Domains in SCOPe 2.07: d1emcd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1emcA (A:)
    maskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwpt
    lvttlsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtl
    vnrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfktrhniedgsvqla
    dhyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1emcA (A:)
    geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt
    lsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnri
    elkgidfkedgnilghkleynynshnvyimadkqkngikvnfktrhniedgsvqladhyq
    qntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1emcB (B:)
    maskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwpt
    lvttlsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtl
    vnrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfktrhniedgsvqla
    dhyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1emcB (B:)
    geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt
    lsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnri
    elkgidfkedgnilghkleynynshnvyimadkqkngikvnfktrhniedgsvqladhyq
    qntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1emcC (C:)
    maskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwpt
    lvttlsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtl
    vnrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfktrhniedgsvqla
    dhyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1emcC (C:)
    geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt
    lsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnri
    elkgidfkedgnilghkleynynshnvyimadkqkngikvnfktrhniedgsvqladhyq
    qntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagith
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1emcD (D:)
    maskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwpt
    lvttlsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtl
    vnrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfktrhniedgsvqla
    dhyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1emcD (D:)
    geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt
    lsygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvnri
    elkgidfkedgnilghkleynynshnvyimadkqkngikvnfktrhniedgsvqladhyq
    qntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit