PDB entry 1emb

View 1emb on RCSB PDB site
Description: green fluorescent protein (gfp) from aequorea victoria, gln 80 replaced with arg
Class: fluorescent protein
Keywords: fluorescent protein, beta-barrel
Deposited on 1997-01-08, released 1997-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-12, with a file datestamp of 2009-05-08.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: 0.196
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42212
      • chromophore (65)
    Domains in SCOPe 2.07: d1emba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1embA (A:)
    mskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
    vttfgygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlv
    nrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqlad
    hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1embA (A:)
    skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
    ttfgygvqcfsrypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlvn
    rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh
    yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi