PDB entry 1em7

View 1em7 on RCSB PDB site
Description: helix variant of the b1 domain from streptococcal protein g
Class: membrane protein
Keywords: helix propensity, helix dipole interaction, protein design, protein G
Deposited on 2000-03-16, released 2002-05-08
The last revision prior to the SCOP 1.75 freeze date was dated 2002-05-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.235
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein g
    Species: Streptococcus sp.
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06654 (0-55)
      • conflict (0)
      • engineered (23)
      • engineered (27)
      • engineered (31)
      • conflict (34)
      • engineered (35)
    Domains in SCOP 1.75: d1em7a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1em7A (A:)
    ttyklilngktlkgettteavdaetaervfkeyakkngvdgewtyddatktftvte