PDB entry 1em7

View 1em7 on RCSB PDB site
Description: helix variant of the b1 domain from streptococcal protein g
Class: membrane protein
Keywords: helix propensity, helix dipole interaction, protein design, protein G, MEMBRANE PROTEIN
Deposited on 2000-03-16, released 2002-05-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein g
    Species: Streptococcus sp. [TaxId:1306]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06654 (0-55)
      • conflict (0)
      • engineered (23)
      • engineered (27)
      • engineered (31)
      • conflict (34)
      • engineered (35)
    Domains in SCOPe 2.08: d1em7a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1em7A (A:)
    ttyklilngktlkgettteavdaetaervfkeyakkngvdgewtyddatktftvte