PDB entry 1em6

View 1em6 on RCSB PDB site
Description: human liver glycogen phosphorylase a complexed with glcnac and cp-526,423
Class: transferase
Keywords: allosteric site, allosteric binding, TRANSFERASE
Deposited on 2000-03-16, released 2000-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.233
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: liver glycogen phosphorylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06737
      • see remark 999 (569)
    Domains in SCOPe 2.07: d1em6a_
  • Chain 'B':
    Compound: liver glycogen phosphorylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06737
      • see remark 999 (569)
    Domains in SCOPe 2.07: d1em6b_
  • Heterogens: NBG, CP4, PLP, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1em6A (A:)
    makpltdqekrrqisirgivgvenvaelkksfnrhlhftlvkdrnvattrdyyfalahtv
    rdhlvgrwirtqqhyydkcpkrvyylslefymgrtlqntminlglqnacdeaiyqlgldi
    eeleeieedaglgngglgrlaacfldsmatlglaaygygiryeygifnqkirdgwqveea
    ddwlrygnpweksrpefmlpvhfygkvehtntgtkwidtqvvlalpydtpvpgymnntvn
    tmrlwsarapndfnlrdfnvgdyiqavldrnlaenisrvlypndnffegkelrlkqeyfv
    vaatlqdiirrfkaskfgstrgagtvfdafpdqvaiqlndthpalaipelmrifvdiekl
    pwskaweltqktfaytnhtvlpealerwpvdlvekllprhleiiyeinqkhldrivalfp
    kdvdrlrrmslieeegskrinmahlcivgshavngvakihsdivktkvfkdfselepdkf
    qnktngitprrwlllcnpglaeliaekigedyvkdlsqltklhsflgddvflrelakvkq
    enklkfsqfleteykvkinpssmfdvqvkriheykrqllnclhvitmynrikkdpkklfv
    prtviiggkaapgyhmakmiiklitsvadvvnndpmvgsklkviflenyrvslaekvipa
    tdlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenlfifgmriddva
    aldkkgyeakeyyealpelklvidqidngffspkqpdlfkdiinmlfyhdrfkvfadyea
    yvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqniwnvepsdlkislsne
    snkvngn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1em6A (A:)
    envaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkr
    vyylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaa
    cfldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvh
    fygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapgdyiqavldrnl
    aenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkastvfdafpdqvaiqlndt
    hpalaipelmrifvdieklpwskaweltqktfaytnhtvlpealerwpvdlvekllprhl
    eiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivgshavngvakihs
    divktkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekigedyvkdlsqltk
    lhsflgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvkriheykrqllnc
    lhvitmynrikkdpfvprtviiggkaapgyhmakmiiklitsvadvvnndpmvgsklkvi
    flenyrvslaekvipatdlseqistagteasgtgnmkfmlngaltigtmdganvemaeea
    geenlfifgmriddvaaldkkgyeakeyyealpelklvidqidngffspkqpdlfkdiin
    mlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqn
    iwnveps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1em6B (B:)
    makpltdqekrrqisirgivgvenvaelkksfnrhlhftlvkdrnvattrdyyfalahtv
    rdhlvgrwirtqqhyydkcpkrvyylslefymgrtlqntminlglqnacdeaiyqlgldi
    eeleeieedaglgngglgrlaacfldsmatlglaaygygiryeygifnqkirdgwqveea
    ddwlrygnpweksrpefmlpvhfygkvehtntgtkwidtqvvlalpydtpvpgymnntvn
    tmrlwsarapndfnlrdfnvgdyiqavldrnlaenisrvlypndnffegkelrlkqeyfv
    vaatlqdiirrfkaskfgstrgagtvfdafpdqvaiqlndthpalaipelmrifvdiekl
    pwskaweltqktfaytnhtvlpealerwpvdlvekllprhleiiyeinqkhldrivalfp
    kdvdrlrrmslieeegskrinmahlcivgshavngvakihsdivktkvfkdfselepdkf
    qnktngitprrwlllcnpglaeliaekigedyvkdlsqltklhsflgddvflrelakvkq
    enklkfsqfleteykvkinpssmfdvqvkriheykrqllnclhvitmynrikkdpkklfv
    prtviiggkaapgyhmakmiiklitsvadvvnndpmvgsklkviflenyrvslaekvipa
    tdlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenlfifgmriddva
    aldkkgyeakeyyealpelklvidqidngffspkqpdlfkdiinmlfyhdrfkvfadyea
    yvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqniwnvepsdlkislsne
    snkvngn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1em6B (B:)
    envaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkr
    vyylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaa
    cfldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvh
    fygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapgdyiqavldrnl
    aenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkastvfdafpdqvaiqlndt
    hpalaipelmrifvdieklpwskaweltqktfaytnhtvlpealerwpvdlvekllprhl
    eiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivgshavngvakihs
    divktkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekigedyvkdlsqltk
    lhsflgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvkriheykrqllnc
    lhvitmynrikkdpfvprtviiggkaapgyhmakmiiklitsvadvvnndpmvgsklkvi
    flenyrvslaekvipatdlseqistagteasgtgnmkfmlngaltigtmdganvemaeea
    geenlfifgmriddvaaldkkgyeakeyyealpelklvidqidngffspkqpdlfkdiin
    mlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqn
    iwnveps