PDB entry 1em2

View 1em2 on RCSB PDB site
Description: Star-related lipid transport domain of MLN64
Class: lipid binding protein
Keywords: beta barrel, lipid binding protein
Deposited on 2000-03-14, released 2000-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-11, with a file datestamp of 2010-08-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.207
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mln64 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14849
      • engineered (172)
    Domains in SCOPe 2.07: d1em2a_
  • Heterogens: TAR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1em2A (A:)
    gsdnesdeevagkksfsaqereyirqgkeatavvdqilaqeenwkfeknneygdtvytie
    vpfhgktfilktflpcpaelvyqevilqpermvlwnktvtacqilqrvedntlisydvsa
    gaaggvvsprdfvnvrrierrrdrylssgiatshsakppthkyvrgengpggmivlksas
    nprvctfvwilntdlkgrlprylihqslaatmfefafhlrqriselgar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1em2A (A:)
    sfsaqereyirqgkeatavvdqilaqeenwkfeknneygdtvytievpfhgktfilktfl
    pcpaelvyqevilqpermvlwnktvtacqilqrvedntlisydvsagaaggvvsprdfvn
    vrrierrrdrylssgiatshsakppthkyvrgengpggmivlksasnprvctfvwilntd
    lkgrlprylihqslaatmfefafhlrqriselga