PDB entry 1em1

View 1em1 on RCSB PDB site
Description: x-ray crystal structure for human manganese superoxide dismutase, q143a
Class: oxidoreductase
Keywords: alpha-beta protein, metalloenzyme, OXIDOREDUCTASE
Deposited on 2000-03-14, released 2000-03-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: manganese superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (142)
    Domains in SCOPe 2.07: d1em1a1, d1em1a2
  • Chain 'B':
    Compound: manganese superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (142)
    Domains in SCOPe 2.07: d1em1b1, d1em1b2
  • Heterogens: SO4, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1em1A (A:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnadplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1em1B (B:)
    khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgwgwlgfnkerghlqiaacpnadplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk