PDB entry 1ely

View 1ely on RCSB PDB site
Description: e. coli alkaline phosphatase mutant (s102c)
Class: hydrolase
Keywords: alkaline phosphatase, hydrolase
Deposited on 1998-02-10, released 1998-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.143
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: PHOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00634 (0-448)
      • engineered (101)
    Domains in SCOPe 2.07: d1elya_
  • Chain 'B':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: PHOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00634 (0-448)
      • engineered (101)
    Domains in SCOPe 2.07: d1elyb_
  • Heterogens: ZN, MG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1elyA (A:)
    tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdcaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
    aygphaanvvgltdqtdlfytmkaalglk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1elyB (B:)
    tpempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseita
    arnyaegaggffkgidalpltgqythyalnkktgkpdyvtdcaasatawstgvktyngal
    gvdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpg
    nalekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsda
    aslnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptla
    qmtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkeg
    ntlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlria
    aygphaanvvgltdqtdlfytmkaalglk