PDB entry 1elw

View 1elw on RCSB PDB site
Description: Crystal structure of the TPR1 domain of HOP in complex with a HSC70 peptide
Class: chaperone
Keywords: Hop, Tpr-Domain, Peptide-Complex, Helical Repeat, Hsc70, Hsp70, Protein Binding, CHAPERONE
Deposited on 2000-03-14, released 2000-04-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.18
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tpr1-domain of hop
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1elwa_
  • Chain 'B':
    Compound: tpr1-domain of hop
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1elwb_
  • Chain 'C':
    Compound: hsc70-peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1ELW (0-7)
  • Chain 'D':
    Compound: hsc70-peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1ELW (0-7)
  • Heterogens: NI, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1elwA (A:)
    meqvnelkekgnkalsvgniddalqcyseaikldphnhvlysnrsaayakkgdyqkayed
    gcktvdlkpdwgkgysrkaaaleflnrfeeakrtyeeglkheannpqlkeglqnmear
    

    Sequence, based on observed residues (ATOM records): (download)
    >1elwA (A:)
    eqvnelkekgnkalsvgniddalqcyseaikldphnhvlysnrsaayakkgdyqkayedg
    cktvdlkpdwgkgysrkaaaleflnrfeeakrtyeeglkheannpqlkeglqnmear
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1elwB (B:)
    meqvnelkekgnkalsvgniddalqcyseaikldphnhvlysnrsaayakkgdyqkayed
    gcktvdlkpdwgkgysrkaaaleflnrfeeakrtyeeglkheannpqlkeglqnmear
    

    Sequence, based on observed residues (ATOM records): (download)
    >1elwB (B:)
    meqvnelkekgnkalsvgniddalqcyseaikldphnhvlysnrsaayakkgdyqkayed
    gcktvdlkpdwgkgysrkaaaleflnrfeeakrtyeeglkheannpqlkeglqnm
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.