PDB entry 1elw

View 1elw on RCSB PDB site
Description: Crystal structure of the TPR1 domain of HOP in complex with a HSC70 peptide
Deposited on 2000-03-14, released 2000-04-26
The last revision prior to the SCOP 1.55 freeze date was dated 2000-04-26, with a file datestamp of 2000-04-26.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.18
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1elwa_
  • Chain 'B':
    Domains in SCOP 1.55: d1elwb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1elwA (A:)
    eqvnelkekgnkalsvgniddalqcyseaikldphnhvlysnrsaayakkgdyqkayedg
    cktvdlkpdwgkgysrkaaaleflnrfeeakrtyeeglkheannpqlkeglqnmear
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1elwB (B:)
    meqvnelkekgnkalsvgniddalqcyseaikldphnhvlysnrsaayakkgdyqkayed
    gcktvdlkpdwgkgysrkaaaleflnrfeeakrtyeeglkheannpqlkeglqnm