PDB entry 1elv

View 1elv on RCSB PDB site
Description: crystal structure of the catalytic domain of human complement c1s protease
Deposited on 2000-03-14, released 2001-03-14
The last revision prior to the SCOP 1.67 freeze date was dated 2001-03-14, with a file datestamp of 2001-03-14.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.186
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1elvA (A:)
    dldcgipesiengkvedpestlfgsvirytceepyyymenggggeyhcagngswvnevlg
    pelpkcvpvcgvprepfeekqriiggsdadiknfpwqvffdnpwaggalineywvltaah
    vvegnreptmyvgstsvqtsrlakskmltpehvfihpgwkllavpegrtnfdndialvrl
    kdpvkmgptvspiclpgtssdynlmdgdlglisgwgrtekrdravrlkaarlpvaplrkc
    kevkvekptadaeayvftpnmicaggekgmdsckgdsggafavqdpndktkfyaaglvsw
    gpqcgtyglytrvknyvdwimktmqenstpred
    

    Sequence, based on observed residues (ATOM records): (download)
    >1elvA (A:)
    ldcgipesiengkvedpestlfgsvirytceepyyymegggeyhcagngswvnevlgpel
    pkcvpvcgvprepfiiggsdadiknfpwqvffdnpwaggalineywvltaahvvegnrep
    tmyvgstsvqkmltpehvfihpgwkllavpegrtnfdndialvrlkdpvkmgptvspicl
    pgtssdynlmdgdlglisgwgrtekrdravrlkaarlpvaplrkckevayvftpnmicag
    gekgmdsckgdsggafavqdpndktkfyaaglvswgpqcgtyglytrvknyvdwimktmq
    ens