PDB entry 1elu

View 1elu on RCSB PDB site
Description: complex between the cystine c-s lyase c-des and its reaction product cysteine persulfide.
Class: lyase
Keywords: FeS cluster biosynthesis, pyridoxal 5'-phosphate, thiocysteine, aminoacrylate, enzyme-product complex, LYASE
Deposited on 2000-03-14, released 2000-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.214
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-cysteine/l-cystine c-s lyase
    Species: Synechocystis sp. [TaxId:1147]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1elua_
  • Chain 'B':
    Compound: l-cysteine/l-cystine c-s lyase
    Species: Synechocystis sp. [TaxId:1147]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1elub_
  • Heterogens: K, PDA, CSS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eluA (A:)
    mtmitpslhqfpglanktyfnfggqgilptvaleaitamygylqengpfsiaanqhiqql
    iaqlrqalaetfnvdpntititdnvttgcdivlwgldwhqgdeilltdcehpgiiaivqa
    iaarfgityrffpvaatlnqgdaaavlanhlgpktrlvilshllwntgqvlplaeimavc
    rrhqgnypvrvlvdgaqsagslpldfsrlevdyyaftghkwfagpagvgglyihgdclge
    inptyvgwrsitygakgeptgwaeggkrfevatsaypqyagllaalqlhqrqgtaeeryq
    aicqrseflwrglnqlphvhclatsapqaglvsftvdsplghraivqkleeqriylrtia
    dpdciracchyitdeeeinhllarladfgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eluA (A:)
    qfpglanktyfnfggqgilptvaleaitamygylqengpfsiaanqhiqqliaqlrqala
    etfnvdpntititdnvttgcdivlwgldwhqgdeilltdcehpgiiaivqaiaarfgity
    rffpvaatlnqgdaaavlanhlgpktrlvilshllwntgqvlplaeimavcrrhqgnypv
    rvlvdgaqsagslpldfsrlevdyyaftghkwfagpagvgglyihgdclgeinptyvgwr
    sitygakgeptgwaeggkrfevatsaypqyagllaalqlhqrqgtaeeryqaicqrsefl
    wrglnqlphvhclatsapqaglvsftvdsplghraivqkleeqriylrtiadpdciracc
    hyitdeeeinhllarladfgp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eluB (B:)
    mtmitpslhqfpglanktyfnfggqgilptvaleaitamygylqengpfsiaanqhiqql
    iaqlrqalaetfnvdpntititdnvttgcdivlwgldwhqgdeilltdcehpgiiaivqa
    iaarfgityrffpvaatlnqgdaaavlanhlgpktrlvilshllwntgqvlplaeimavc
    rrhqgnypvrvlvdgaqsagslpldfsrlevdyyaftghkwfagpagvgglyihgdclge
    inptyvgwrsitygakgeptgwaeggkrfevatsaypqyagllaalqlhqrqgtaeeryq
    aicqrseflwrglnqlphvhclatsapqaglvsftvdsplghraivqkleeqriylrtia
    dpdciracchyitdeeeinhllarladfgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eluB (B:)
    qfpglanktyfnfggqgilptvaleaitamygylqengpfsiaanqhiqqliaqlrqala
    etfnvdpntititdnvttgcdivlwgldwhqgdeilltdcehpgiiaivqaiaarfgity
    rffpvaatlnqgdaaavlanhlgpktrlvilshllwntgqvlplaeimavcrrhqgnypv
    rvlvdgaqsagslpldfsrlevdyyaftghkwfagpagvgglyihgdclgeinptyvgwr
    sitygakgeptgwaeggkrfevatsaypqyagllaalqlhqrqgtaeeryqaicqrsefl
    wrglnqlphvhclatsapqaglvsftvdsplghraivqkleeqriylrtiadpdciracc
    hyitdeeeinhllarladfgp