PDB entry 1elt

View 1elt on RCSB PDB site
Description: structure of native pancreatic elastase from north atlantic salmon at 1.61 angstroms resolution
Class: serine proteinase
Keywords: serine proteinase
Deposited on 1995-01-02, released 1996-01-01
The last revision prior to the SCOP 1.73 freeze date was dated 1996-01-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.172
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elastase
    Species: Salmo salar
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1elta_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1eltA (A:)
vvggrvaqpnswpwqislqyksgssyyhtcggslirqgwvmtaahcvdsartwrvvlgeh
nlntnegkeqimtvnsvfihsgwnsddvaggydiallrlntqaslnsavqlaalppsnqi
lpnnnpcyitgwgktstggplsdslkqawlpsvdhatcsssgwwgstvkttmvcagggan
sgcngdsggplncqvngsyyvhgvtsfvsssgcnaskkptvftrvsayiswmngim