PDB entry 1elr

View 1elr on RCSB PDB site
Description: Crystal structure of the TPR2A domain of HOP in complex with the HSP90 peptide MEEVD
Class: chaperone
Keywords: Hop, Tpr-Domain, Peptide-Complex, Helical Repeat, Hsp90, Protein Binding, CHAPERONE
Deposited on 2000-03-14, released 2000-04-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.181
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tpr2a-domain of hop
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31948 (0-End)
      • conflict (0)
    Domains in SCOPe 2.03: d1elra_
  • Chain 'B':
    Compound: hsp90-peptide meevd
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1ELR (Start-4)
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1elrA (A:)
    gkqalkekelgndaykkkdfdtalkhydkakeldptnmtyitnqaavyfekgdynkcrel
    cekaievgrenredyrqiakayarignsyfkeekykdaihfynkslaehrtpdvlkkcqq
    aekilkeqerl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1elrA (A:)
    gkqalkekelgndaykkkdfdtalkhydkakeldptnmtyitnqaavyfekgdynkcrel
    cekaievgrenredyrqiakayarignsyfkeekykdaihfynkslaehrtpdvlkkcqq
    aekilkeq
    

  • Chain 'B':
    No sequence available.