PDB entry 1elr

View 1elr on RCSB PDB site
Description: crystal structure of the tpr2a domain of hop in complex with the hsp90 peptide meevd
Deposited on 2000-03-14, released 2000-04-26
The last revision prior to the SCOP 1.55 freeze date was dated 2000-04-26, with a file datestamp of 2000-04-26.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.181
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1elra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1elrA (A:)
    gkqalkekelgndaykkkdfdtalkhydkakeldptnmtyitnqaavyfekgdynkcrel
    cekaievgrenredyrqiakayarignsyfkeekykdaihfynkslaehrtpdvlkkcqq
    aekilkeq