PDB entry 1elq

View 1elq on RCSB PDB site
Description: crystal structure of the cystine c-s lyase c-des
Class: lyase
Keywords: FeS cluster biosynthesis, NifS, pyridoxal 5'-phosphate, thiocysteine
Deposited on 2000-03-14, released 2000-04-19
The last revision prior to the SCOP 1.73 freeze date was dated 2000-04-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.198
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-cysteine/l-cystine c-s lyase
    Species: Synechocystis sp.
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1elqa_
  • Chain 'B':
    Compound: l-cysteine/l-cystine c-s lyase
    Species: Synechocystis sp.
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1elqb_
  • Heterogens: K, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1elqA (A:)
    mtmitpslhqfpglanktyfnfggqgilptvaleaitamygylqengpfsiaanqhiqql
    iaqlrqalaetfnvdpntititdnvttgcdivlwgldwhqgdeilltdcehpgiiaivqa
    iaarfgityrffpvaatlnqgdaaavlanhlgpktrlvilshllwntgqvlplaeimavc
    rrhqgnypvrvlvdgaqsagslpldfsrlevdyyaftghkwfagpagvgglyihgdclge
    inptyvgwrsitygakgeptgwaeggkrfevatsaypqyagllaalqlhqrqgtaeeryq
    aicqrseflwrglnqlphvhclatsapqaglvsftvdsplghraivqkleeqriylrtia
    dpdciracchyitdeeeinhllarladfgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1elqA (A:)
    qfpglanktyfnfggqgilptvaleaitamygylqengpfsiaanqhiqqliaqlrqala
    etfnvdpntititdnvttgcdivlwgldwhqgdeilltdcehpgiiaivqaiaarfgity
    rffpvaatlnqgdaaavlanhlgpktrlvilshllwntgqvlplaeimavcrrhqgnypv
    rvlvdgaqsagslpldfsrlevdyyaftghkwfagpagvgglyihgdclgeinptyvgwr
    sitygakgeptgwaeggkrfevatsaypqyagllaalqlhqrqgtaeeryqaicqrsefl
    wrglnqlphvhclatsapqaglvsftvdsplghraivqkleeqriylrtiadpdciracc
    hyitdeeeinhllarladfgp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1elqB (B:)
    mtmitpslhqfpglanktyfnfggqgilptvaleaitamygylqengpfsiaanqhiqql
    iaqlrqalaetfnvdpntititdnvttgcdivlwgldwhqgdeilltdcehpgiiaivqa
    iaarfgityrffpvaatlnqgdaaavlanhlgpktrlvilshllwntgqvlplaeimavc
    rrhqgnypvrvlvdgaqsagslpldfsrlevdyyaftghkwfagpagvgglyihgdclge
    inptyvgwrsitygakgeptgwaeggkrfevatsaypqyagllaalqlhqrqgtaeeryq
    aicqrseflwrglnqlphvhclatsapqaglvsftvdsplghraivqkleeqriylrtia
    dpdciracchyitdeeeinhllarladfgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1elqB (B:)
    qfpglanktyfnfggqgilptvaleaitamygylqengpfsiaanqhiqqliaqlrqala
    etfnvdpntititdnvttgcdivlwgldwhqgdeilltdcehpgiiaivqaiaarfgity
    rffpvaatlnqgdaaavlanhlgpktrlvilshllwntgqvlplaeimavcrrhqgnypv
    rvlvdgaqsagslpldfsrlevdyyaftghkwfagpagvgglyihgdclgeinptyvgwr
    sitygakgeptgwaeggkrfevatsaypqyagllaalqlhqrqgtaeeryqaicqrsefl
    wrglnqlphvhclatsapqaglvsftvdsplghraivqkleeqriylrtiadpdciracc
    hyitdeeeinhllarladfgp