PDB entry 1elo

View 1elo on RCSB PDB site
Description: elongation factor g without nucleotide
Class: elongation factor
Keywords: ribosomal translocase, GTP binding protein, hydrolase, elongation factor
Deposited on 1996-03-13, released 1996-08-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.23
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eloA (A:)
    mavkveydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqere
    rgititaavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqset
    vwrqaekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidv
    lrmkaytygndlgtdireipipeeyldqareyheklvevaadfdenimlkylegeeptee
    elvaairkgtidlkitpvflgsalknkgvqllldavvdylpspldippikgttpegevve
    ihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvynttkgrkervarllrmha
    nhreeveelkagdlgavvglketitgdtlvgedaprvilesievpepvidvaiepktkad
    qeklsqalarlaeedptfrvsthpetgqtiisgmgelhleiivdrlkrefkvdanvgkpq
    vayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkeyip
    avqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkgdpv
    ilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdlr
    sktqgrgsfvmffdhyqevpkqvqeklikgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eloA (A:)
    veydlkrlrnigiaahidagktttterilyytgriavttcfwkdhriniidtpghvdfti
    eversmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgadlwlvirt
    mqerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeeyldqarey
    heklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalknkgvqll
    ldavvdylpspldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvys
    gtltsgsyvynttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvge
    daprvilidvaiepksqalarlaeedptfrvsthpqtiisgmgelhleiivdrlkrefvg
    kpqvayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipke
    yipavqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkg
    dpvilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyat
    dlrsktqgrgsfvmffdhyqevpkqvqeklik