PDB entry 1elo

View 1elo on RCSB PDB site
Description: elongation factor g without nucleotide
Class: elongation factor
Keywords: ribosomal translocase, GTP binding protein, hydrolase, elongation factor
Deposited on 1996-03-13, released 1996-08-01
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.23
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor G
    Species: Thermus thermophilus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1eloa1, d1eloa2, d1eloa3, d1eloa4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eloA (A:)
    mavkveydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqere
    rgititaavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqset
    vwrqaekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidv
    lrmkaytygndlgtdireipipeeyldqareyheklvevaadfdenimlkylegeeptee
    elvaairkgtidlkitpvflgsalknkgvqllldavvdylpspldippikgttpegevve
    ihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvynttkgrkervarllrmha
    nhreeveelkagdlgavvglketitgdtlvgedaprvilesievpepvidvaiepktkad
    qeklsqalarlaeedptfrvsthpetgqtiisgmgelhleiivdrlkrefkvdanvgkpq
    vayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkeyip
    avqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkgdpv
    ilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdlr
    sktqgrgsfvmffdhyqevpkqvqeklikgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eloA (A:)
    veydlkrlrnigiaahidagktttterilyytgriavttcfwkdhriniidtpghvdfti
    eversmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgadlwlvirt
    mqerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeeyldqarey
    heklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalknkgvqll
    ldavvdylpspldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvys
    gtltsgsyvynttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvge
    daprvilidvaiepksqalarlaeedptfrvsthpqtiisgmgelhleiivdrlkrefvg
    kpqvayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipke
    yipavqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkg
    dpvilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyat
    dlrsktqgrgsfvmffdhyqevpkqvqeklik