PDB entry 1elo

View 1elo on RCSB PDB site
Description:
Deposited on 1996-03-13, released 1996-08-01
The last revision prior to the SCOP 1.55 freeze date was dated 1996-08-01, with a file datestamp of 1996-08-02.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.23
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1elo_ (-)
    veydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqerergit
    itaavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqsetvwrq
    aekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidvlrmk
    aytygndlgtdireipipeeyldqareyheklvevaadfdenimlkylegeepteeelva
    airkgtidlkitpvflgsalknkgvqllldavvdylpspldippikgttpegevveihpd
    pngplaalafkimadpyvgrltfirvysgtltsgsyvynttkgrkervarllrmhanhre
    eveelkagdlgavvglketitgdtlvgedaprvilesievpepvidvaiepktkadqekl
    sqalarlaeedptfrvsthpetgqtiisgmgelhleiivdrlkrefkvdanvgkpqvayr
    etitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkeyipavqk
    gieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkgdpvilep
    imrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdlrsktq
    grgsfvmffdhyqevpkqvqeklik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1elo_ (-)
    veydlkrlrnigiaahidagktttterilyytgriavttcfwkdhriniidtpghvdfti
    eversmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgadlwlvirt
    mqerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeeyldqarey
    heklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalknkgvqll
    ldavvdylpspldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvys
    gtltsgsyvynttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvge
    daprvilidvaiepksqalarlaeedptfrvsthpqtiisgmgelhleiivdrlkrefvg
    kpqvayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipke
    yipavqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkg
    dpvilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyat
    dlrsktqgrgsfvmffdhyqevpkqvqeklik