PDB entry 1ell

View 1ell on RCSB PDB site
Description: cadmium-substituted bovine pancreatic carboxypeptidase a (alfa-form) at ph 7.5 and 0.25 m chloride in monoclinic crystal form.
Class: hydrolase
Keywords: alfa/beta fold, hydrolase
Deposited on 2000-03-14, released 2002-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: carboxypeptidase a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00730 (0-End)
      • allelic variant (227)
      • allelic variant (304)
    Domains in SCOPe 2.07: d1ellp_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1ellP (P:)
    arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
    sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtvnnly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ellP (P:)
    arstntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrp
    aiwidlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafth
    sqnrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksiv
    dfvkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsyky
    gsiittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvlti
    mehtv