PDB entry 1elk

View 1elk on RCSB PDB site
Description: VHS domain of TOM1 protein from H. sapiens
Class: endocytosis/exocytosis
Keywords: Superhelix of helices, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2000-03-13, released 2000-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.193
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: target of myb1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60784 (4-156)
      • engineered (4)
    Domains in SCOPe 2.07: d1elka_
  • Chain 'B':
    Compound: target of myb1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60784 (4-156)
      • engineered (4)
    Domains in SCOPe 2.07: d1elkb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1elkA (A:)
    gamgsdfllgnpfsspvgqriekatdgslqsedwalnmeicdiineteegpkdalravkk
    rivgnknfhevmlaltvletcvkncghrfhvlvasqdfvesvlvrtilpknnpptivhdk
    vlnliqswadafrsspdltgvvtiyedlrrkglefpm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1elkA (A:)
    sdfllgnpfsspvgqriekatdgslqsedwalnmeicdiineteegpkdalravkkrivg
    nknfhevmlaltvletcvkncghrfhvlvasqdfvesvlvrtilpknnpptivhdkvlnl
    iqswadafrsspdltgvvtiyedlrrkglefpm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1elkB (B:)
    gamgsdfllgnpfsspvgqriekatdgslqsedwalnmeicdiineteegpkdalravkk
    rivgnknfhevmlaltvletcvkncghrfhvlvasqdfvesvlvrtilpknnpptivhdk
    vlnliqswadafrsspdltgvvtiyedlrrkglefpm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1elkB (B:)
    sdfllgnpfsspvgqriekatdgslqsedwalnmeicdiineteegpkdalravkkrivg
    nknfhevmlaltvletcvkncghrfhvlvasqdfvesvlvrtilpknnpptivhdkvlnl
    iqswadafrsspdltgvvtiyedlrrkglefpm