PDB entry 1ele

View 1ele on RCSB PDB site
Description: structural analysis of the active site of porcine pancreatic elastase based on the x-ray crystal structures of complexes with trifluoroacetyl-dipeptide-anilide inhibitors
Class: hydrolase (serine proteinase)
Keywords: hydrolase (serine proteinase)
Deposited on 1994-10-24, released 1995-02-14
The last revision prior to the SCOP 1.73 freeze date was dated 1995-02-14, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.171
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'E':
  Compound: elastase
  Species: Sus scrofa
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00772 (0-239)
    • conflict (65)
  Domains in SCOP 1.73: d1elee_
• Chain 'I':
  Compound: trifluoroacetyl-l-valyl-l-alanyl-p-trifluoromethylaninide
  
• Heterogens: CA, SO4, HOH

PDB Chain Sequences:

• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eleE (E:)
  vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
  nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
  lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
  rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn
  

  
  
• Chain 'I':
  No sequence available.