PDB entry 1elc

View 1elc on RCSB PDB site
Description: analogous inhibitors of elastase do not always bind analogously
Class: hydrolase(serine proteinase)
Keywords: hydrolase(serine proteinase)
Deposited on 1993-12-07, released 1994-04-30
The last revision prior to the SCOP 1.75 freeze date was dated 1994-04-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.15
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elastase
    Species: Sus scrofa
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00772 (0-239)
      • conflict (65)
    Domains in SCOP 1.75: d1elca_
  • Chain 'B':
    Compound: trifluoroacetyl-l-phenylalanyl -p-isopropylanilid
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1elcA (A:)
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

  • Chain 'B':
    No sequence available.