PDB entry 1ela

View 1ela on RCSB PDB site
Description: Analogous inhibitors of elastase do not always bind analogously
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase-hydrolase inhibitor complex, serine proteinase
Deposited on 1993-12-07, released 1994-04-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elastase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00772 (0-239)
      • conflict (65)
    Domains in SCOPe 2.06: d1elaa_
  • Heterogens: 0Z1, CA, SO4, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1elaA (A:)
    vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
    nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
    lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
    rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn