PDB entry 1el6

View 1el6 on RCSB PDB site
Description: structure of bacteriophage t4 gene product 11, the interface between the baseplate and short tail fibers
Class: structural protein
Keywords: beta annulus, coiled coil, a fiber attachment protein, STRUCTURAL PROTEIN
Deposited on 2000-03-13, released 2000-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.208
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: baseplate structural protein gp11
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1el6a_
  • Chain 'B':
    Compound: baseplate structural protein gp11
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1el6b_
  • Chain 'C':
    Compound: baseplate structural protein gp11
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1el6c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1el6A (A:)
    msllnnkagvisrladflgfrpktgdidvmnrqsvgsvtisqlakgfyepniesaindvh
    nfsikdvgtiitnktgvspegvsqtdywafsgtvtddslppgspitvlvfglpvsattgm
    taiefvakvrvalqeaiasftainsykdhptdgsklevtyldnqkhvlstystygitisq
    eiiseskpgygtwnllgaqtvtldnqqtptvfyhferta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1el6A (A:)
    srladflgfrpktgdidvmnrqsvgsvtisqlakgfyepniesaindvhnfsikdvgtii
    tnktgvspegvsqtdywafsgtvtddslppgspitvlvfglpvsattgmtaiefvakvrv
    alqeaiasftainsykdhptdgsklevtyldnqkhvlstystygitisqeiiseskpgyg
    twnllgaqtvtldnqqtptvfyhferta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1el6B (B:)
    msllnnkagvisrladflgfrpktgdidvmnrqsvgsvtisqlakgfyepniesaindvh
    nfsikdvgtiitnktgvspegvsqtdywafsgtvtddslppgspitvlvfglpvsattgm
    taiefvakvrvalqeaiasftainsykdhptdgsklevtyldnqkhvlstystygitisq
    eiiseskpgygtwnllgaqtvtldnqqtptvfyhferta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1el6B (B:)
    srladflgfrpktgdidvmnrqsvgsvtisqlakgfyepniesaindvhnfsikdvgtii
    tnktgvspegvsqtdywafsgtvtddslppgspitvlvfglpvsattgmtaiefvakvrv
    alqeaiasftainsykdhptdgsklevtyldnqkhvlstystygitisqeiiseskpgyg
    twnllgaqtvtldnqqtptvfyhferta
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1el6C (C:)
    msllnnkagvisrladflgfrpktgdidvmnrqsvgsvtisqlakgfyepniesaindvh
    nfsikdvgtiitnktgvspegvsqtdywafsgtvtddslppgspitvlvfglpvsattgm
    taiefvakvrvalqeaiasftainsykdhptdgsklevtyldnqkhvlstystygitisq
    eiiseskpgygtwnllgaqtvtldnqqtptvfyhferta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1el6C (C:)
    srladflgfrpktgdidvmnrqsvgsvtisqlakgfyepniesaindvhnfsikdvgtii
    tnktgvspegvsqtdywafsgtvtddslppgspitvlvfglpvsattgmtaiefvakvrv
    alqeaiasftainsykdhptdgsklevtyldnqkhvlstystygitisqeiiseskpgyg
    twnllgaqtvtldnqqtptvfyhferta