PDB entry 1el4

View 1el4 on RCSB PDB site
Description: structure of the calcium-regulated photoprotein obelin determined by sulfur sas
Deposited on 2000-03-13, released 2001-03-13
The last revision prior to the SCOP 1.59 freeze date was dated 2001-03-13, with a file datestamp of 2001-03-13.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.188
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1el4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1el4A (A:)
    sskyavklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqt
    krhqvcveaffrgcgmeygkeiafpqfldgwkqlatselkkwarneptlirewgdavfdi
    fdkdgsgtitldewkaygkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwyt
    ldpeadglygngvp