PDB entry 1el4

View 1el4 on RCSB PDB site
Description: structure of the calcium-regulated photoprotein obelin determined by sulfur sas
Class: luminescent protein
Keywords: bioluminescence, calcium, photoprotein, obelin, sulfur anomalous scattering, luminescent protein
Deposited on 2000-03-13, released 2001-03-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.188
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: obelin
    Species: Obelia longissima [TaxId:32570]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1el4a_
  • Heterogens: CL, CTZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1el4A (A:)
    msskyavklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeq
    tkrhqvcveaffrgcgmeygkeiafpqfldgwkqlatselkkwarneptlirewgdavfd
    ifdkdgsgtitldewkaygkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwy
    tldpeadglygngvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1el4A (A:)
    sskyavklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqt
    krhqvcveaffrgcgmeygkeiafpqfldgwkqlatselkkwarneptlirewgdavfdi
    fdkdgsgtitldewkaygkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwyt
    ldpeadglygngvp