PDB entry 1el3

View 1el3 on RCSB PDB site
Description: human aldose reductase complexed with idd384 inhibitor
Class: oxidoreductase
Keywords: aldose reductase, inhibition, diabetes, oxidoreductase
Deposited on 2000-03-13, released 2000-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.165
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldose reductase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1el3a_
  • Heterogens: NAP, I84, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1el3A (A:)
    masrlllnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiq
    eklreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgk
    effpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykp
    avnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaak
    hnkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvca
    llsctshkdypfheef