PDB entry 1el1

View 1el1 on RCSB PDB site
Description:
Deposited on 2000-03-13, released 2001-03-13
The last revision prior to the SCOP 1.63 freeze date was dated 2001-03-13, with a file datestamp of 2001-03-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.159
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1el1a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1el1b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1el1A (A:)
    skifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafngrnsngssdygifql
    nskwwcksnshssanacnimcskflddnidddiacakrvvkdpngmsawvawvkhckgkd
    lskylascnl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1el1B (B:)
    skifskcelarklksmgmdgfhgyslanwvcmaeyesnfntqafngrnsngssdygifql
    nskwwcksnshssanacnimcskflddnidddiacakrvvkdpngmsawvawvkhckgkd
    lskylascnl