PDB entry 1el0

View 1el0 on RCSB PDB site
Description: solution structure of the human cc chemokine, I-309
Class: immune system
Keywords: chemokine fold, IMMUNE SYSTEM
Deposited on 2000-03-11, released 2000-09-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: I-309
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1el0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1el0A (A:)
sksmqvpfsrccfsfaeqeiplrailcyrntssicsneglifklkrgkeacaldtvgwvq
rhrkmlrhcpskrk