PDB entry 1ekz

View 1ekz on RCSB PDB site
Description: nmr structure of the complex between the third dsrbd from drosophila staufen and a RNA hairpin
Class: cell cycle/RNA
Keywords: NMR structure, protein/RNA, protein dsRBD, Drosophila, RNA hairpin
Deposited on 2000-03-11, released 2000-08-21
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR36
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maternal effect protein (staufen)
    Species: Drosophila melanogaster
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ekza_
  • Chain 'B':
    Compound: staufen double-stranded RNA binding domain

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ekzA (A:)
mdegdkkspisqvheigikrnmtvhfkvlreegpahmknfitacivgsivtegegngkkv
skkraaekmlvelqkl

  • Chain 'B':
    No sequence available.