PDB entry 1ekz

View 1ekz on RCSB PDB site
Description: nmr structure of the complex between the third dsrbd from drosophila staufen and a rna hairpin
Deposited on 2000-03-11, released 2000-08-21
The last revision prior to the SCOP 1.55 freeze date was dated 2000-08-21, with a file datestamp of 2000-08-21.
Experiment type: NMR36
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1ekza_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ekzA (A:)
  mdegdkkspisqvheigikrnmtvhfkvlreegpahmknfitacivgsivtegegngkkv
  skkraaekmlvelqkl