PDB entry 1eky

View 1eky on RCSB PDB site
Description: model structure from non-noe based nmr structure calculation
Class: oxygen storage/transport
Keywords: four helix bundle, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2000-03-10, released 2000-03-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c'
  Species: Rhodobacter capsulatus [TaxId:1061]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00147 (0-128)
    • variant (18)
    • variant (29)
    • variant (37)
    • variant (41)
    • variant (75)
    • variant (78)
    • variant (88-89)
    • variant (92-93)
    • variant (103-104)
  Domains in SCOPe 2.08: d1ekya_
• Heterogens: HEM

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ekyA (A:)
  adtkevleareayfkslggsmkamtgvakafdaeaakveaaklekilatdvaplfpagts
  stdlpgqteakaaiwanmddfgakgkamheaggaviaaanagdgaafgaalqklggtcka
  chddyreed