PDB entry 1ekx

View 1ekx on RCSB PDB site
Description: the isolated, unregulated catalytic trimer of aspartate transcarbamoylase complexed with bisubstrate analog pala (n-(phosphonacetyl)-l-aspartate)
Class: transferase
Keywords: ATCase catalytic subunit, bisubstrate analog complex
Deposited on 2000-03-09, released 2000-05-12
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.171
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate transcarbamoylase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ekxa1, d1ekxa2
  • Chain 'B':
    Compound: aspartate transcarbamoylase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ekxb1, d1ekxb2
  • Chain 'C':
    Compound: aspartate transcarbamoylase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ekxc1, d1ekxc2
  • Heterogens: CA, PAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ekxA (A:)
    manplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsf
    etsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefs
    gnvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakf
    dgnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpse
    yanvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqal
    lalvlnrdlvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ekxA (A:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdlvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ekxB (B:)
    manplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsf
    etsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefs
    gnvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakf
    dgnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpse
    yanvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqal
    lalvlnrdlvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ekxB (B:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ekxC (C:)
    manplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsf
    etsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefs
    gnvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakf
    dgnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpse
    yanvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqal
    lalvlnrdlvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ekxC (C:)
    anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
    tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
    nvpvlnagdgsnqhptqtlldlftiqetqgrldnlhvamvgdlkygrtvhsltqalakfd
    gnrfyfiapdalampqyildmldekgiawslhssieevmaevdilymtrvqkerldpsey
    anvkaqfvlrasdlhnakanmkvlhplprvdeiatdvdktphawyfqqagngifarqall
    alvlnrdl