PDB entry 1eku

View 1eku on RCSB PDB site
Description: crystal structure of a biologically active single chain mutant of human ifn-gamma
Class: immune system
Keywords: cytokine, protein engineering, interferon, immune system
Deposited on 2000-03-09, released 2000-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: -1.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interferon gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01579 (1-121)
      • initiating methionine (0)
      • engineered mutation (111)
      • engineered mutation (120)
    • Uniprot P01579 (129-End)
    Domains in SCOPe 2.07: d1ekua1, d1ekua2
  • Chain 'B':
    Compound: interferon gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01579 (1-121)
      • initiating methionine (0)
      • engineered mutation (111)
      • engineered mutation (120)
    • Uniprot P01579 (129-264)
    Domains in SCOPe 2.07: d1ekub1, d1ekub2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ekuA (A:)
    mqdpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfkn
    fkddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaideliqvmae
    fsteeqqegpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfy
    fklfknfkddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaihel
    iqvmaelspaaktgkrkrsqmlfrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ekuA (A:)
    mqdpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfkn
    fkddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaideliqvmae
    fsteeqqegpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfy
    fklfknfkddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaihel
    iqvmaelspmlf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ekuB (B:)
    mqdpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfkn
    fkddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaideliqvmae
    fsteeqqegpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfy
    fklfknfkddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaihel
    iqvmaelspaaktgkrkrsqmlfrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ekuB (B:)
    mqdpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfyfklfkn
    fkddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaideliqvmae
    fsteeqqegpyvkeaenlkkyfnaghsdvadngtlflgilknwkeesdrkimqsqivsfy
    fklfknfkddqsiqksvetikedmnvkffnsnkkkrddfekltnysvtdlnvqrkaihel
    iqvmaelsqmlfrg