PDB entry 1ekt

View 1ekt on RCSB PDB site
Description: solution structure of the n-terminal dna recognition domain of the bacillus subtilis transcription-state regulator abrb
Deposited on 2000-03-09, released 2000-12-13
The last revision prior to the SCOP 1.55 freeze date was dated 2000-12-13, with a file datestamp of 2000-12-13.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ekta_
  • Chain 'B':
    Domains in SCOP 1.55: d1ektb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ektA (A:)
    mkstgivrkvdelgrvvipielrrtlgiaekdaleiyvddekiilkkykpnmt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ektB (B:)
    mkstgivrkvdelgrvvipielrrtlgiaekdaleiyvddekiilkkykpnmt