PDB entry 1ekt

View 1ekt on RCSB PDB site
Description: solution structure of the n-terminal DNA recognition domain of the bacillus subtilis transcription-state regulator abrb
Class: transcription
Keywords: Novel DNA recognition topology
Deposited on 2000-03-09, released 2000-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2005-03-15, with a file datestamp of 2007-04-25.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription state regulatory protein abrb
    Species: Bacillus subtilis
    Gene: ABRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ekta_
  • Chain 'B':
    Compound: transcription state regulatory protein abrb
    Species: Bacillus subtilis
    Gene: ABRB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ektb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ektA (A:)
    mkstgivrkvdelgrvvipielrrtlgiaekdaleiyvddekiilkkykpnmt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ektB (B:)
    mkstgivrkvdelgrvvipielrrtlgiaekdaleiyvddekiilkkykpnmt