PDB entry 1eks

View 1eks on RCSB PDB site
Description: asp128ala variant of moac protein from e. coli
Class: translation
Keywords: MoaC, Molybdenum cofactor (Moco), Moco biosynthesis, Moco deficiency, TRANSLATION
Deposited on 2000-03-09, released 2000-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Molybdenum cofactor biosynthesis protein C
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A738
      • variant (127)
    Domains in SCOPe 2.07: d1eksa_
  • Heterogens: TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eksA (A:)
    maqlthinaageahmvdvsakaetvrearaeafvtmrsetlamiidgrhhkgdvfatari
    agiqaakrtwdliplchplmlskvevnlqaepehnrvrietlcrltgktgvemealtaas
    vaaltiyamckavqkdmvigpvrllaksggksgdfkveadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eksA (A:)
    mvdvsakaetvrearaeafvtmrsetlamiidgrhhkgdvfatariagiqaakrtwdlip
    lchplmlskvevnlqaepehnrvrietlcrltgktgvemealtaasvaaltiyamckavq
    kdmvigpvrllaksksgdfk