PDB entry 1ekr

View 1ekr on RCSB PDB site
Description: moac protein from e. coli
Class: translation
Keywords: MoaC, Molybdenum cofactor (Moco), Moco biosynthesis, Moco deficiency, TRANSLATION
Deposited on 2000-03-09, released 2000-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.219
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Molybdenum cofactor biosynthesis protein C
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ekra_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ekrA (A:)
    maqlthinaageahmvdvsakaetvrearaeafvtmrsetlamiidgrhhkgdvfatari
    agiqaakrtwdliplchplmlskvevnlqaepehnrvrietlcrltgktgvemealtaas
    vaaltiydmckavqkdmvigpvrllaksggksgdfkveadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ekrA (A:)
    geahmvdvsakaetvrearaeafvtmrsetlamiidgrhhkgdvfatariagiqaakrtw
    dliplchplmlskvevnlqaepehnrvrietlcrltgktgvemealtaasvaaltiydmc
    kavqkdmvigpvrllakssgdfk