PDB entry 1ekq

View 1ekq on RCSB PDB site
Description: crystal structure of hydroxyethylthiazole kinase in r3 space group
Class: transferase
Keywords: Alpha-beta, TRANSFERASE
Deposited on 2000-03-09, released 2000-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.216
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydroxyethylthiazole kinase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39593 (0-End)
      • modified residue (197)
    Domains in SCOPe 2.07: d1ekqa_
  • Chain 'B':
    Compound: hydroxyethylthiazole kinase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39593 (0-End)
      • modified residue (197)
    Domains in SCOPe 2.07: d1ekqb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ekqA (A:)
    mdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakiag
    alvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaai
    rgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviaitgevdviadtshv
    ytlhnghklltkvtgagclltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkg
    pgsfqiellnklstvteqdvqewatiervtvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ekqA (A:)
    mdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakiag
    alvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaai
    rgnaaeiahtvggdiirlaqqaaqklntviaitgevdviadtshvytlhnghklltkvtg
    agclltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkgpgsfqiellnklstv
    teqdvqewatierv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ekqB (B:)
    mdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakiag
    alvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaai
    rgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviaitgevdviadtshv
    ytlhnghklltkvtgagclltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkg
    pgsfqiellnklstvteqdvqewatiervtvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ekqB (B:)
    mdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakiag
    alvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaai
    rgnaaeiahtvgggdiirlaqqaaqklntviaitgevdviadtshvytlhnghklltkvt
    gagclltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkgpgsfqiellnklst
    vteqdvqewatierv