PDB entry 1ekp

View 1ekp on RCSB PDB site
Description: crystal structure of human branched chain amino acid aminotransferase (mitochondrial) complexed with pyridoxal-5'-phosphate at 2.5 angstroms (monoclinic form).
Class: transferase
Keywords: fold type IV, transferase
Deposited on 2000-03-09, released 2001-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.155
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: branched chain amino acid aminotransferase (mitochondrial)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ekpa_
  • Chain 'B':
    Compound: branched chain amino acid aminotransferase (mitochondrial)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ekpb_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ekpA (A:)
    asssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpfqnlt
    lhpassslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdklellec
    irrlievdkdwvpdaagtslyvrpvlignepslgvsqprrallfvilcpvgayfpggsvt
    pvslladpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqltevgt
    mnifvywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkqllral
    eegrvrevfgsgtacqvcpvhrilykdrnlhiptmengpelilrfqkelkeiqygirahe
    wmfpv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ekpB (B:)
    asssfkaadlqlemtqkphkkpgpgeplvfgktftdhmlmvewndkgwgqpriqpfqnlt
    lhpassslhyslqlfegmkafkgkdqqvrlfrpwlnmdrmlrsamrlclpsfdklellec
    irrlievdkdwvpdaagtslyvrpvlignepslgvsqprrallfvilcpvgayfpggsvt
    pvslladpafirawvggvgnyklggnygptvlvqqealkrgceqvlwlygpdhqltevgt
    mnifvywthedgvlelvtpplngvilpgvvrqslldmaqtwgefrvvertitmkqllral
    eegrvrevfgsgtacqvcpvhrilykdrnlhiptmengpelilrfqkelkeiqygirahe
    wmfpv