PDB entry 1eko

View 1eko on RCSB PDB site
Description: pig aldose reductase complexed with idd384 inhibitor
Class: oxidoreductase
Keywords: aldose reductase, inhibition, diabetes, oxidoreductase
Deposited on 2000-03-09, released 2000-05-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldose reductase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80276 (0-314)
      • modified residue (0)
    Domains in SCOPe 2.07: d1ekoa_
  • Heterogens: NAP, I84, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ekoA (A:)
    ashlvlytgakmpilglgtwksppgkvteavkvaidlgyrhidcahvyqnenevglglqe
    klqgqvvkredlfivsklwctdheknlvkgacqttlrdlkldyldlylihwptgfkpgkd
    pfpldgdgnvvpdesdfvetweameelvdeglvkaigvsnfnhlqvekilnkpglkykpa
    vnqievhpyltqeklieyckskgivvtaysplgspdrpwakpedpslledprikaiaaky
    nkttaqvlirfpmqrnlivipksvtperiaenfqvfdfelspedmntllsynrnwrvcal
    mscashkdypfheey