PDB entry 1ekm

View 1ekm on RCSB PDB site
Description:
Deposited on 2000-03-09, released 2000-08-23
The last revision prior to the SCOP 1.55 freeze date was dated 2000-08-23, with a file datestamp of 2000-08-23.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.183
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ekmA (A:)
    aparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplpp
    rlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavie
    qcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpiv
    dteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtg
    nvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkh
    aldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkh
    sdfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilntyilgd
    deeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygn
    afysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakeg
    slvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilf
    fhtfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ekmB (B:)
    aparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplpp
    rlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavie
    qcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpiv
    dteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtg
    nvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkh
    aldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkh
    sdfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilntyilgd
    deeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygn
    afysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakeg
    slvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilf
    fhtfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ekmC (C:)
    aparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplpp
    rlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavie
    qcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpiv
    dteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtg
    nvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkh
    aldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkh
    sdfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilntyilgd
    deeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygn
    afysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakeg
    slvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilf
    fhtfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav