PDB entry 1ekm

View 1ekm on RCSB PDB site
Description: crystal structure at 2.5 a resolution of zinc-substituted copper amine oxidase of hansenula polymorpha expressed in escherichia coli
Class: oxidoreductase
Keywords: amine oxidase, quinoprotein, OXIDOREDUCTASE
Deposited on 2000-03-09, released 2000-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.183
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: copper amine oxidase
    Species: Pichia angusta [TaxId:4905]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ekma1, d1ekma2, d1ekma3
  • Chain 'B':
    Compound: copper amine oxidase
    Species: Pichia angusta [TaxId:4905]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ekmb1, d1ekmb2, d1ekmb3
  • Chain 'C':
    Compound: copper amine oxidase
    Species: Pichia angusta [TaxId:4905]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ekmc1, d1ekmc2, d1ekmc3
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ekmA (A:)
    aparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplpp
    rlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavie
    qcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpiv
    dteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtg
    nvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkh
    aldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkh
    sdfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilntyilgd
    deeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygn
    afysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakeg
    slvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilf
    fhtfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ekmB (B:)
    aparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplpp
    rlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavie
    qcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpiv
    dteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtg
    nvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkh
    aldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkh
    sdfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilntyilgd
    deeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygn
    afysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakeg
    slvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilf
    fhtfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ekmC (C:)
    aparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggplpp
    rlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpavie
    qcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcpiv
    dteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkmtg
    nvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpygspefphqrkh
    aldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllfkh
    sdfrdnfatslvtratklvvsqiftaanyeyclywvfmqdgairldirltgilntyilgd
    deeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmygn
    afysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllakeg
    slvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdilf
    fhtfgithfpapedfplmpaepitlmlrprhfftenpgldiqpsyamttseakrav