PDB entry 1ekl

View 1ekl on RCSB PDB site
Description: type III antifreeze protein isoform hplc 12 e35k
Class: antifreeze protein
Keywords: antifreeze protein, mutant, ice binding protein, thermal hysteresis protein
Deposited on 1999-01-21, released 1999-04-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.21
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (antifreeze protein type III)
  Species: Macrozoarces americanus [TaxId:8199]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19614 (1-65)
    • engineered (35)
    • engineered (64-65)
  Domains in SCOPe 2.08: d1ekla_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eklA (A:)
  anqasvvanqlipintaltlvmmrsevvtpvgipakdiprlvsmqvnravplgttlmpdm
  vkgyaa