PDB entry 1ekk

View 1ekk on RCSB PDB site
Description: crystal structure of hydroxyethylthiazole kinase in the r3 form with hydroxyethylthiazole
Deposited on 2000-03-09, released 2000-08-09
The last revision prior to the SCOP 1.55 freeze date was dated 2000-08-09, with a file datestamp of 2000-08-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ekka_
  • Chain 'B':
    Domains in SCOP 1.55: d1ekkb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ekkA (A:)
    mdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakiag
    alvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaai
    rgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviaitgevdviadtshv
    ytlhnghklltkvtgagclltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkg
    pgsfqiellnklstvteqdvqewatierv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ekkB (B:)
    mdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakiag
    alvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaai
    rgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviaitgevdviadtshv
    ytlhnghklltkvtgagclltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkg
    pgsfqiellnklstvteqdvqewatierv