PDB entry 1ekj

View 1ekj on RCSB PDB site
Description: the x-ray crystallographic structure of beta carbonic anhydrase from the c3 dicot pisum sativum
Class: lyase
Keywords: rossman fold domain, strand exchange, lyase
Deposited on 2000-03-08, released 2000-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.229
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-carbonic anhydrase
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ekja_
  • Chain 'B':
    Compound: beta-carbonic anhydrase
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ekjb_
  • Chain 'C':
    Compound: beta-carbonic anhydrase
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ekjc_
  • Chain 'D':
    Compound: beta-carbonic anhydrase
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ekjd_
  • Chain 'E':
    Compound: beta-carbonic anhydrase
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ekje_
  • Chain 'F':
    Compound: beta-carbonic anhydrase
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ekjf_
  • Chain 'G':
    Compound: beta-carbonic anhydrase
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ekjg_
  • Chain 'H':
    Compound: beta-carbonic anhydrase
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ekjh_
  • Heterogens: ACT, AZI, ZN, CL, CU, EDO, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ekjA (A:)
    ttsssdgipkseaseriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcps
    hvldfqpgeafvvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikg
    llsfpfdgtystdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnllty
    pfvreglvnktlalkggyydfvkgsfelwglefglsstfsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ekjA (A:)
    easeriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcpshvldfqpgeaf
    vvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikgllsfpfdgtys
    tdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnlltypfvreglvnkt
    lalkggyydfvkgsfelwglefglsstfsv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ekjB (B:)
    ttsssdgipkseaseriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcps
    hvldfqpgeafvvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikg
    llsfpfdgtystdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnllty
    pfvreglvnktlalkggyydfvkgsfelwglefglsstfsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ekjB (B:)
    pkseaseriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcpshvldfqpg
    eafvvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikgllsfpfdg
    tystdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnlltypfvreglv
    nktlalkggyydfvkgsfelwglefglsstfsv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ekjC (C:)
    ttsssdgipkseaseriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcps
    hvldfqpgeafvvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikg
    llsfpfdgtystdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnllty
    pfvreglvnktlalkggyydfvkgsfelwglefglsstfsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ekjC (C:)
    sdgipkseaseriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcpshvld
    fqpgeafvvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikgllsf
    pfdgtystdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnlltypfvr
    eglvnktlalkggyydfvkgsfelwglefglsstfsv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ekjD (D:)
    ttsssdgipkseaseriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcps
    hvldfqpgeafvvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikg
    llsfpfdgtystdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnllty
    pfvreglvnktlalkggyydfvkgsfelwglefglsstfsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ekjD (D:)
    seaseriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcpshvldfqpgea
    fvvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikgllsfpfdgty
    stdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnlltypfvreglvnk
    tlalkggyydfvkgsfelwglefglsstfsv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ekjE (E:)
    ttsssdgipkseaseriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcps
    hvldfqpgeafvvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikg
    llsfpfdgtystdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnllty
    pfvreglvnktlalkggyydfvkgsfelwglefglsstfsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ekjE (E:)
    kseaseriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcpshvldfqpge
    afvvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikgllsfpfdgt
    ystdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnlltypfvreglvn
    ktlalkggyydfvkgsfelwglefglsstfsv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ekjF (F:)
    ttsssdgipkseaseriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcps
    hvldfqpgeafvvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikg
    llsfpfdgtystdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnllty
    pfvreglvnktlalkggyydfvkgsfelwglefglsstfsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ekjF (F:)
    ipkseaseriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcpshvldfqp
    geafvvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikgllsfpfd
    gtystdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnlltypfvregl
    vnktlalkggyydfvkgsfelwglefglsstfsv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ekjG (G:)
    ttsssdgipkseaseriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcps
    hvldfqpgeafvvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikg
    llsfpfdgtystdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnllty
    pfvreglvnktlalkggyydfvkgsfelwglefglsstfsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ekjG (G:)
    tsssdgipkseaseriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcpsh
    vldfqpgeafvvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikgl
    lsfpfdgtystdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnlltyp
    fvreglvnktlalkggyydfvkgsfelwglefglsstfsv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ekjH (H:)
    ttsssdgipkseaseriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcps
    hvldfqpgeafvvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikg
    llsfpfdgtystdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnllty
    pfvreglvnktlalkggyydfvkgsfelwglefglsstfsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ekjH (H:)
    seaseriktgflhfkkekydknpalygelakgqsppfmvfacsdsrvcpshvldfqpgea
    fvvrnvanlvppydqakyagtgaaieyavlhlkvsnivvighsacggikgllsfpfdgty
    stdfieewvkiglpakakvkaqhgdapfaelcthcekeavnaslgnlltypfvreglvnk
    tlalkggyydfvkgsfelwglefglsstfsv